Protein Info for MIT1002_03761 in Alteromonas macleodii MIT1002

Annotation: N-carbamoyl-D-amino acid hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00795: CN_hydrolase" amino acids 7 to 275 (269 residues), 211.7 bits, see alignment E=6e-67

Best Hits

Swiss-Prot: 40% identical to AGUB_SOLLC: N-carbamoylputrescine amidase (CPA) from Solanum lycopersicum

KEGG orthology group: K12251, N-carbamoylputrescine amidase [EC: 3.5.1.53] (inferred from 99% identity to amc:MADE_00672)

MetaCyc: 54% identical to N-carbamoylputrescine amidohydrolase (Campylobacter jejuni jejuni 81116)
N-carbamoylputrescine amidase. [EC: 3.5.1.53]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.53

Use Curated BLAST to search for 3.5.1.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>MIT1002_03761 N-carbamoyl-D-amino acid hydrolase (Alteromonas macleodii MIT1002)
MRPAKLKVGLVQQAVADNDKATNWNKSAEQIAKLAAEGCECILLQELHSTLYFCQQEDTD
AFDLAEPIPGPATEFFGELAEKHNIVLVTSLFEKRGSGLYHNTAVVFDRSKEIAGKYRKM
HIPDDPGFYEKFYFTPGDMGFTPIETSVGKLGVLVCWDQWYPEAARLMAMAGADLLFYPT
AIGWDLTDTEEERTRQHGAWETIQRSHAVANSVPVIVANRTGFEASPVEGDPGIQFWGQS
FVAGPQGEILAKAEAEGETTLTVELDMERTEQVKRIWPYFRDRRIDAYDELTKRWRD