Protein Info for MIT1002_03754 in Alteromonas macleodii MIT1002

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 64 to 118 (55 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 14 to 58 (45 residues), 43.8 bits, see alignment 2.8e-15 PF00924: MS_channel_2nd" amino acids 109 to 172 (64 residues), 48.7 bits, see alignment E=9.7e-17 PF21082: MS_channel_3rd" amino acids 178 to 260 (83 residues), 57.6 bits, see alignment E=2.1e-19

Best Hits

Swiss-Prot: 32% identical to Y639_SYNY3: Uncharacterized MscS family protein slr0639 (slr0639) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 91% identity to amc:MADE_00678)

Predicted SEED Role

"Mechanosensitive ion channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>MIT1002_03754 Small-conductance mechanosensitive channel (Alteromonas macleodii MIT1002)
MDELKQAQALYDTLVEFAVTYSFQIVGAIIIFLLGWWVANKIGHIVENLMVSRNIDITLS
RFTGGASKLVVLGIVIIIALGNVGISVTPLIAAVGAVGLGAGLAIQGMLANYAAGFTIII
TRPFVVGDTIRVRGVAGVVAQVMLPYTILIDEDNVHIQIPNKLIVGEILHNSAENMLIEL
EIGVAYSSKVDEVIDVIRKAVETVDGVSEEKSPAIGVDNFGDSSINFGIRVWAPAVRHFE
VRYALNQAIFNALQQHDIEIPFPQREVRMLDQ