Protein Info for MIT1002_03750 in Alteromonas macleodii MIT1002

Annotation: Dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00856: dihydroorotase, homodimeric type
  • amino acids 4 to 342 (339 residues), 443.2 bits, E=2.8e-137
• PF01979: Amidohydro_1
  • amino acids 11 to 304 (294 residues), 52 bits, E=6.5e-18
• PF04909: Amidohydro_2
  • amino acids 84 to 178 (95 residues), 26.8 bits, E=4.4e-10

Best Hits

Swiss-Prot: 74% identical to PYRC_SHEFN: Dihydroorotase (pyrC) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 98% identity to amc:MADE_00682)

MetaCyc: 54% identical to dihydroorotase (Escherichia coli K-12 substr. MG1655)
Dihydroorotase. [EC: 3.5.2.3]

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.3

Protein Sequence (348 amino acids)

>MIT1002_03750 Dihydroorotase (Alteromonas macleodii MIT1002)
MQTLTITTPDDWHLHFRDNEMLAETVPATARCFQRAIVMPNLVPPVVNAEMAMAYKGRIE
AARPKGSSFEPLMTLFLTNQTTPQDIIDAKQAGVTACKLYPAGATTNSDAAVKGIQALYP
VFQAMQEQGLLLLIHGEVTEHHIDIFDREKVFIDTHLGPIVDAFPKLKVVFEHITTADAA
SFVAGASEFVGATITPQHLLLNRNDLLVGGVRPHNYCLPVLKRNTHQKALRDMVASGNKK
FFLGTDSAPHAKHKKENACGCAGCYSAWSAIELYAEVFEQLGAIDKLEGFASHYGADFYG
LPRNTTTMTLVKESWTVPEQVTLADGTDMVPFYAGQTLQWKLEKAFQA