Protein Info for MIT1002_03726 in Alteromonas macleodii MIT1002

Annotation: Monoterpene epsilon-lactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 64 to 81 (18 residues), see Phobius details amino acids 118 to 119 (2 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details PF10340: Say1_Mug180" amino acids 83 to 222 (140 residues), 21.2 bits, see alignment E=1.2e-08 PF07859: Abhydrolase_3" amino acids 97 to 295 (199 residues), 109.2 bits, see alignment E=2.5e-35

Best Hits

KEGG orthology group: None (inferred from 57% identity to alt:ambt_19600)

Predicted SEED Role

"Esterase/lipase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>MIT1002_03726 Monoterpene epsilon-lactone hydrolase (Alteromonas macleodii MIT1002)
MSKPNEPKTQTVSDALKHAIEKFPTTPIAEVKATVPQDAARWRELVQQRNAQQKKKIKNM
RKQLGVSVELLEIAGVTVRMLTPKEVSPHFENHVYIDVHGGAYVFFGGLPSIEEGLLIAS
RLGIIVLSIDYAMPPNAPAPATLCDLKAVYLALLDSVDIRCILVGGTSAGAGLVLALIQS
LAAESISLPCAIYTGTPWVDLTQAGDSRQVNEGADRVLVTYEGLLQSAAALYAGTIDLSH
PSVSPIYGDFTSFPPVFIVAGTRDLFLSDAVRLHRKIRDFNGTSQLEIVEGLSHAEYLIA
HETPESYMTYDELRAFFLQHL