Protein Info for MIT1002_03725 in Alteromonas macleodii MIT1002

Annotation: TonB-dependent receptor Fiu

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07715: Plug" amino acids 64 to 165 (102 residues), 68.5 bits, see alignment E=6.7e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 65 to 737 (673 residues), 277.6 bits, see alignment E=1.2e-86 PF00593: TonB_dep_Rec_b-barrel" amino acids 288 to 706 (419 residues), 150 bits, see alignment E=2.1e-47

Best Hits

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>MIT1002_03725 TonB-dependent receptor Fiu (Alteromonas macleodii MIT1002)
MKKMNTKKSALALTVTAAIPFGTALAQQENTAVQELETTKVQATEEAGYKVDETSSVKLT
QPIANTPRSINVISERLLEDQGITNLNDALRNVAGVSTFGGGEGGGGVVSASDKVTIRGF
DARSNIYVDGIRDIAGYSRDTFNYEAVEVIKGGSGSLDGRSTGGGSVNLATKRARLEDFG
AVSGRYDSFENARVTLDYNKKLSESVAGRLNLLYSDGGDFFDNGVEEYQTTGVAGSLLYK
VNEATDINLDVFVMEQDNVPVLGLPFLTSAAAEATGQPEGPIDSGLWDEYYSVPGRDFEE
VSTQMYTLVINHKVNDVVTLRSQTRFGSNEKESVIGRPWWNSGEEANLLNAERLQALDEE
TDLFVSQLDAILSLESGALKHRVVLGAEVAEEERTSFGVTANYTYVDGQGNVLEAPTINP
FDLQNNVFVTGGTTRSGNDTSGDASTVALYLLDTIKVGEHLQVDINARYDDFDISGSACG
RRSGCFDGLDAQDSYFSYGAAVSYMPTENGNIYLSHSNSKQPPGVALALSTNAAQNAVRP
ENAVTTELGVKWQFFNDQLLVSGAVFETTKDVVDSQNIEDGVTVYSLAGEQESKGYEVSV
TGMLTDSLSISANYASLDTEVTQDTTADSIGNGLQASPDDTANIWVNYAAMDNKLNVGGG
IYYNSGETYWRRNTAYFTVDSYTTLFLMASYQVTEDLKLQLNVDNLTDEEYVVDYSAKGH
FRPGNPRSVAVFANYTF