Protein Info for MIT1002_03691 in Alteromonas macleodii MIT1002

Annotation: Glutamyl-Q tRNA(Asp) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 5 to 265 (261 residues), 331.5 bits, see alignment E=1.9e-103 PF00749: tRNA-synt_1c" amino acids 8 to 244 (237 residues), 148 bits, see alignment E=1.6e-47

Best Hits

Swiss-Prot: 51% identical to GLUQ_SHEON: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 50% identity to tau:Tola_2297)

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>MIT1002_03691 Glutamyl-Q tRNA(Asp) synthetase (Alteromonas macleodii MIT1002)
MHNHYVGRFAPSPSGQLHFGSLVTAVASYLDAKSHNGKWLLRMEDIDEPRCIKGVDKDIL
TTLEAHGLYWDGGVIYQSQQHARYQAVLDDLLTQQKAYFCTCTRKQIKAMGGVYNGYCRT
EPVHSNTQDCAVRLKVDTQLEAFDDVLMGKVMPSNSSSDLIAEDVVLKRRDGLFSYNLVV
ILDDVFQQVNHVIRGCDLIDVTPLQRAVYHTLGYSTPEYGHVPVAAVAPGRKLSKQNRAA
PVKNESALDNLVRVMHFLGFSFPNASEFGDIDSALKTAISMWNRKKVVKTPEIIVPQHES
TYYSEPL