Protein Info for MIT1002_03690 in Alteromonas macleodii MIT1002

Annotation: DnaK suppressor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02420: RNA polymerase-binding protein DksA" amino acids 30 to 138 (109 residues), 167.8 bits, see alignment E=4.6e-54 PF21157: DksA_N" amino acids 34 to 104 (71 residues), 115.3 bits, see alignment E=1.2e-37 PF01258: zf-dskA_traR" amino acids 108 to 138 (31 residues), 37.9 bits, see alignment 1.4e-13

Best Hits

Swiss-Prot: 77% identical to DKSA_ECOLI: RNA polymerase-binding transcription factor DksA (dksA) from Escherichia coli (strain K12)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 98% identity to alt:ambt_19485)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>MIT1002_03690 DnaK suppressor protein (Alteromonas macleodii MIT1002)
MPTGKETKSLGLLALAGLQPYEPKADEEYMGEPQMEHFRLLLKAWRNQLREEVDRTVTHM
KDEAANFPDPVDRAAQEEEFSLELRTRDRERKLIKKIEKTLKRIEEDDFGFCDQCGIEIG
IRRLEARPTADLCIDCKTMAEIKEKQLQG