Protein Info for MIT1002_03685 in Alteromonas macleodii MIT1002

Annotation: putative antibiotic transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details PF01914: MarC" amino acids 4 to 192 (189 residues), 185.1 bits, see alignment E=5.4e-59 TIGR00427: membrane protein, MarC family" amino acids 8 to 189 (182 residues), 105.2 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 61% identical to YHGN_ECOLI: UPF0056 inner membrane protein YhgN (yhgN) from Escherichia coli (strain K12)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 98% identity to amc:MADE_03540)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>MIT1002_03685 putative antibiotic transporter (Alteromonas macleodii MIT1002)
MDTWSAAIMLFLIMDPLGNLPVFMSVLKSIEPKRRQVILIRELLFALGILFLFLFSGQSV
LNFLNVEQETVSIAGGIILFLIALKMIFPSSGNPSGLAVGEEPFLVPLAIPMIAGPSTLA
ALILLANQAPDRMADWSIALAASWSISAVILLFSNVFHKILGERGLVAMERLMGMILVMI
AIQMLLDGVTQYFMHATGAL