Protein Info for MIT1002_03683 in Alteromonas macleodii MIT1002

Annotation: Ribosomal RNA small subunit methyltransferase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 46 to 229 (184 residues), 191.2 bits, see alignment E=7.8e-61 PF03602: Cons_hypoth95" amino acids 49 to 227 (179 residues), 190.5 bits, see alignment E=2.3e-60 PF05175: MTS" amino acids 85 to 176 (92 residues), 26.4 bits, see alignment E=4.8e-10

Best Hits

Swiss-Prot: 46% identical to RSMD_HAEIN: Ribosomal RNA small subunit methyltransferase D (rsmD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 82% identity to amc:MADE_03538)

Predicted SEED Role

"16S rRNA (guanine(966)-N(2))-methyltransferase (EC 2.1.1.171)" (EC 2.1.1.171)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MIT1002_03683 Ribosomal RNA small subunit methyltransferase D (Alteromonas macleodii MIT1002)
MYERMIPLSATMKRVSRPTRAPSSAKKPYSSQKGKKSRKTQSTNSPGQIRIIGGQWRGRK
LPVLNAEGLRPTTDRNKETLFNWLMPYINDARCLDVFAGSGGLGLEALSRYAAHCDFIEL
DKQAASQLKSNLTLLKANELASATVHQGDALGILKGISQAPYDIIFVDPPFAKSLVAPTL
AALEDNKLVHSGSVVYLEHESALTTPALPAHWQIIKDKQTSALRYMLIEIC