Protein Info for MIT1002_03680 in Alteromonas macleodii MIT1002

Annotation: Cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details PF18075: FtsX_ECD" amino acids 84 to 169 (86 residues), 51.8 bits, see alignment E=1.1e-17 PF02687: FtsX" amino acids 201 to 318 (118 residues), 46.8 bits, see alignment E=2.7e-16

Best Hits

Swiss-Prot: 46% identical to FTSX_AERHY: Cell division protein FtsX (ftsX) from Aeromonas hydrophila

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 95% identity to amc:MADE_03535)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>MIT1002_03680 Cell division protein FtsX (Alteromonas macleodii MIT1002)
MSILFKGRAKGASSAKVGFVQSIVMFFVSHVRQALASLGELWRQPLASLMTIGVLGLSIT
LPSTLYIMVKNTEKITAGWDQASEISLFLKPDINAASSQQLVARLNSWSEIDSVVYIPAD
DALKEFQHLSGLGDAIAYLEKNPLPDVVLVTPNEKHASPTAAKALLDKLRQQREVDIGKL
DIEWLERLYAVIDIARDLVTLIGLLLFIAVVLIIGNTIRLNILNKYDEIVVMKLVGATDA
FIHRPFLYTGFWYGLLGGLMAWLAVIIILWWMDSSITTFAAMYQKDFNITGLTGSALLTM
LGLSVLLGLLGSLISVQRHVREIEPK