Protein Info for MIT1002_03668 in Alteromonas macleodii MIT1002

Annotation: NADP-dependent malic enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00390: malic
  • amino acids 28 to 116 (89 residues), 72.8 bits, E=3.3e-24
  • amino acids 113 to 149 (37 residues), 26.9 bits, 4e-10
• PF03949: Malic_M
  • amino acids 164 to 357 (194 residues), 90.4 bits, E=1.3e-29

Best Hits

Swiss-Prot: 70% identical to MAEB_HALED: NADP-dependent malic enzyme (maeB) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K00029, malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC: 1.1.1.40] (inferred from 97% identity to amc:MADE_03522)

Predicted SEED Role

"NADP-dependent malic enzyme (EC 1.1.1.40)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 1.1.1.40)

MetaCyc Pathways

• gluconeogenesis I (13/13 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• methylgallate degradation (2/6 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• syringate degradation (3/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.40

Protein Sequence (411 amino acids)

>MIT1002_03668 NADP-dependent malic enzyme (Alteromonas macleodii MIT1002)
MSDFRQRALDYHAKPTPGKIRVELSKPADSVDDLALAYSPGVAEPVREIAEDADNAYKYT
GKGNLVAVISNGTAILGLGNLGPLASKPVMEGKALLFKRFAGLDAIDIEVKHRTTEEFIN
TVANIADTFGGINLEDIKAPECFEIEQELIKRCKIPVFHDDQHGTAIVTAAGMLNALEIQ
GKSIESAKIVCMGAGAAAVACMELLIKCGAQRERIYMLDRKGVIHTRREDLTEHKKLFAN
NTDKRTLEDVMEGADIFVGVSGPDVLPPETLALMAENPIVFACSNPDPEIKPELAHEVRK
DLIMATGRSDYPNQVNNVLCFPFIFRGALDVRATAINDEMKVAAVEALRAITKEPVPEEV
LAASKSTSLTFGKEYIIPKPMDPRLCERIATAVSKAAIESGVARVPESPEE