Protein Info for MIT1002_03660 in Alteromonas macleodii MIT1002

Annotation: ATP-dependent protease subunit HslV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR03692: ATP-dependent protease HslVU, peptidase subunit" amino acids 1 to 157 (157 residues), 264.4 bits, see alignment E=1.9e-83 PF00227: Proteasome" amino acids 1 to 155 (155 residues), 74.1 bits, see alignment E=6.2e-25

Best Hits

Swiss-Prot: 87% identical to HSLV_VIBVY: ATP-dependent protease subunit HslV (hslV) from Vibrio vulnificus (strain YJ016)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 99% identity to amc:MADE_03517)

MetaCyc: 83% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>MIT1002_03660 ATP-dependent protease subunit HslV (Alteromonas macleodii MIT1002)
MAGDGQVSLGNTVMKGNARKVRRLYHDKILAGFAGGTADAFTLFERFEAKLEAHQGHLTK
AAVELAKDWRTDRALRKLEALLAVADETASFIITGNGDVVQPEQDLIAIGSGGNYAQAAA
TALLENTELSAKEIAEKALTIAGDICVFTNHSQTVDVLDY