Protein Info for MIT1002_03659 in Alteromonas macleodii MIT1002

Annotation: Unfoldase HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 442 (439 residues), 728.9 bits, see alignment E=1.1e-223 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 25 bits, see alignment 5.1e-09 PF00004: AAA" amino acids 53 to 99 (47 residues), 30.2 bits, see alignment 1.7e-10 amino acids 235 to 331 (97 residues), 33.2 bits, see alignment E=1.9e-11 PF07724: AAA_2" amino acids 183 to 328 (146 residues), 101.8 bits, see alignment E=1.3e-32

Best Hits

Swiss-Prot: 98% identical to HSLU_ALTMD: ATP-dependent protease ATPase subunit HslU (hslU) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 98% identity to amc:MADE_03516)

MetaCyc: 78% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>MIT1002_03659 Unfoldase HslU (Alteromonas macleodii MIT1002)
MSEMTPREIVHELDRHIIGQQDAKRAVSIALRNRWRRMQLEPELRQEVTPKNILMIGPTG
VGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVETIIRDLADIAVKMTKENEMKKVK
FRAEEAAEERILDVLLPPPEDAWGNKENVEDRGTRQAFRKKLRQGDLDDKEIEIDVALPQ
VGVEIMAPPGMEEMTNQLQGMFQNLSGSQKKKKKLKIKEAFKLLIEEEAARLVNQEDLKE
KAIESVEQHGIVFIDEIDKICKREGNSSADVSREGVQRDLLPLVEGSTVSTKHGMVKTDH
ILFIASGAFQMSKPSDLIPELQGRLPIRVELSALKVGDFKRILTEPNASLTHQYIALMKT
EGVDISFDDSGIQRIAEAAWQVNERTENIGARRLHTVLERLMEDISFDASEKSGESFVID
ADYVNSHLETLVDNEDLSRFIL