Protein Info for MIT1002_03617 in Alteromonas macleodii MIT1002

Annotation: Bacterial leucyl aminopeptidase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF04389: Peptidase_M28" amino acids 131 to 333 (203 residues), 74.8 bits, see alignment E=3.9e-25

Best Hits

Swiss-Prot: 37% identical to M28P3_PHANO: Probable zinc metalloprotease SNOG_06590 (SNOG_06590) from Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)

KEGG orthology group: None (inferred from 92% identity to amc:MADE_03479)

Predicted SEED Role

"Leucine aminopeptidase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>MIT1002_03617 Bacterial leucyl aminopeptidase precursor (Alteromonas macleodii MIT1002)
MIKNRPALASISAKIRTELTKVLASAVLVSSTVSFAAHAQSEQQQTLYDIAKNVSAENIE
KDITTLVNFGTRHTLSETESDTRGIGAARRWIKSEFDKISAECGGCLEVYYQSEVISGEK
RIPDPVEVVSVIAIQRGTTDPDRYVIMSGDIDSRVSDVMDFTSDSPGANDNASGVAGTLE
AARVLSKYKFNGSIVYAALSGEEQGLFGGRIMANQAKEDGWRIKAVLNNDMIGNIEGVNG
VINNTTARLFAEGTRVTETDKDARMRRFTGGEVDSPSRNLARYIDKIADQYIENLDTMVI
YRLDRFGRGGHHRPFNDLGYPGIRIMETNENYTRQHQDLRVEDGIAYGDTLDGVDFDYAA
KLTGLNAVSLAAMAWAPNPPANVEIAGAVQPSTFLKWDALDAEENPQLKGYKVYWRHTDA
PQWEYSKYVGNVTEAMLENVVIDNYFFGVASVNKDGVESVVVYPGPAGSFGE