Protein Info for MIT1002_03560 in Alteromonas macleodii MIT1002

Annotation: Glucose-1-phosphate thymidylyltransferase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00483: NTP_transferase" amino acids 3 to 239 (237 residues), 254.8 bits, see alignment E=9.3e-80 TIGR01207: glucose-1-phosphate thymidylyltransferase" amino acids 3 to 287 (285 residues), 498 bits, see alignment E=3.4e-154 PF12804: NTP_transf_3" amino acids 4 to 135 (132 residues), 35.5 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 69% identical to RMLA1_SHIFL: Glucose-1-phosphate thymidylyltransferase 1 (rfbA) from Shigella flexneri

KEGG orthology group: K00973, glucose-1-phosphate thymidylyltransferase [EC: 2.7.7.24] (inferred from 97% identity to amc:MADE_00988)

MetaCyc: 68% identical to glucose-1-phosphate thymidylyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate thymidylyltransferase. [EC: 2.7.7.24]

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>MIT1002_03560 Glucose-1-phosphate thymidylyltransferase 1 (Alteromonas macleodii MIT1002)
MRKGIILAGGSGTRLHPLTKVVSKQLMPVYDKPMIFYPLTTLMMSGIRDVLIITTPEEQQ
RFIDLIGDGSALGMNIQYAVQPSPDGLAQAFLIGEQFIGNDSCSLVLGDNIYYGHDLKLS
LQNAYKQEHGATVFGYHVNDPERYGVVEFDDDWNALSIEEKPAVPRSNYAVTGLYYYDNR
VVDFAKEVKPSPRGELEITDLNNLYLKDGSLKVELMGRGSAWLDTGTLDSLLDAANFVAA
IEKRQGLKVCCPEEVAFRMGYIDAEQLEKLAAPLKKSGYGDYLLKVINDRVKI