Protein Info for MIT1002_03539 in Alteromonas macleodii MIT1002

Annotation: Bifunctional protein BirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 132 to 148 (17 residues), see Phobius details amino acids 155 to 170 (16 residues), see Phobius details PF08279: HTH_11" amino acids 9 to 61 (53 residues), 40.3 bits, see alignment 3.5e-14 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 87 to 326 (240 residues), 191.8 bits, see alignment E=7.1e-61 PF03099: BPL_LplA_LipB" amino acids 91 to 217 (127 residues), 84.9 bits, see alignment E=7.1e-28 PF02237: BPL_C" amino acids 283 to 326 (44 residues), 30.1 bits, see alignment 5.5e-11

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to amc:MADE_03573)

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15) / Biotin operon repressor" in subsystem Biotin biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>MIT1002_03539 Bifunctional protein BirA (Alteromonas macleodii MIT1002)
MRQASKAIRKHILALLSDGQFHSGETIAQQVGLSRTAVAGHISQLADWGLDVFKVKGKGY
RLERGFPLLSADSIKRHLGNTKRAVIDVESVLPSTNTEMKKRIASKREDLENGDVVFAEI
QTDGRGRHGRSWLAPVGGSLTFSMYWSFPDGYQSMAGLSLLVGLAVCDALKEFGVEDAEL
KWPNDIYLQGKKLAGVLIEVEGQIGATAHSVIGIGLNVCVPDNQYDVGQPHSDLASYLGT
IPDRNALAAEIIKSLWSYLPKFTQQGFGPFTAYWEALDLYADKRIVLQMGEKRFSGIDRG
VDASGALLVETQDGITRFHGGEVSLRGN