Protein Info for MIT1002_03504 in Alteromonas macleodii MIT1002

Annotation: Stalked cell differentiation-controlling protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00072: Response_reg" amino acids 16 to 126 (111 residues), 88.6 bits, see alignment E=3.2e-29 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 139 to 306 (168 residues), 132.5 bits, see alignment E=6.1e-43 PF00990: GGDEF" amino acids 144 to 303 (160 residues), 136.6 bits, see alignment E=6.9e-44

Best Hits

KEGG orthology group: None (inferred from 89% identity to amc:MADE_00724)

Predicted SEED Role

"Putative diguanylate cyclase (GGDEF domain)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>MIT1002_03504 Stalked cell differentiation-controlling protein (Alteromonas macleodii MIT1002)
MYIEQVGDRTLADCKVLIVDDQASSRLVLETLLEDTFACASVGSGKEAIEYCKYHTPDLI
LMDVSMPELDGHQTTALLRKKPLCAHIPIIFVTSSSSDEEESRCWESGCVDFVVKPVNAC
TLRNRVKSHINHKLRNDLLEKLIYVDKLTGAYNRHYLDDYLPRLVRDGLRNVTPLSLVIF
DVDHFKLFNDMYGHIDGDSCLWKVSKTINDALLRPMDKLVRIGGEEFLVILPNTDVDGAK
AVTERLLRTVYDLNIPHAASEYERVTLSAGLAVKHADDNKTIDYVMLEADKNLYVAKTSG
RNQLVAPTAVSAGKINAPSHPTKLKA