Protein Info for MIT1002_03502 in Alteromonas macleodii MIT1002

Annotation: Immunogenic protein MPT70 precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02469: Fasciclin" amino acids 39 to 161 (123 residues), 139.9 bits, see alignment E=2.6e-45

Best Hits

Swiss-Prot: 57% identical to Y1483_SYNY3: Uncharacterized protein sll1483 (sll1483) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 68% identity to alt:ambt_00345)

Predicted SEED Role

"Sensory subunit of low CO2-induced protein complex, putative" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>MIT1002_03502 Immunogenic protein MPT70 precursor (Alteromonas macleodii MIT1002)
MKKLISAFFLVVLSASALAGHHAKDGHKDIVDTAASNDMFSTLVTAVKSADLVTTLKGDG
PFTVFAPTDEAFAALPADTVEMLLKPENKQTLVKILTYHVVTGKVTAKDVAGLSDATTVE
GSKVMVSTDMNKVMINDANVIKADIMTSNGVIHVIDTVLLPNDVKVAL