Protein Info for MIT1002_03498 in Alteromonas macleodii MIT1002

Annotation: Uridine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00235: uridine kinase
  • amino acids 3 to 205 (203 residues), 243.8 bits, E=6.9e-77
• PF00485: PRK
  • amino acids 6 to 193 (188 residues), 143.3 bits, E=4.2e-46

Best Hits

Swiss-Prot: 52% identical to URK_PECCP: Uridine kinase (udk) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00876, uridine kinase [EC: 2.7.1.48] (inferred from 100% identity to amc:MADE_00730)

Predicted SEED Role

"Uridine kinase (EC 2.7.1.48)" (EC 2.7.1.48)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• nucleoside and nucleotide degradation (archaea) (2/10 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.48

Protein Sequence (207 amino acids)

>MIT1002_03498 Uridine kinase (Alteromonas macleodii MIT1002)
MQSPLIIAISGASGSGKSLFTKNLFNGFSAQGRPVQVLREDHYYRAQDHLPMEQREKNNY
DHPNAFEHELLKAHLQALRDGQPIDYPHYCYKTHTRLPETERLNPAPVIILEGIMLLART
DLLPLYDVKIFIDTPLDICLMRRMMRDLKERGRSIESVAKQYEETVKPMYHQFIEPSRFT
ADVVVTQGGKNQIALDVIKSHIQQALL