Protein Info for MIT1002_03490 in Alteromonas macleodii MIT1002

Annotation: FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF01346: FKBP_N" amino acids 10 to 107 (98 residues), 93.1 bits, see alignment E=1.6e-30 PF00254: FKBP_C" amino acids 114 to 202 (89 residues), 106.8 bits, see alignment E=5.9e-35

Best Hits

Swiss-Prot: 56% identical to FKBB_SHIFL: FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase (fklB) from Shigella flexneri

KEGG orthology group: K03773, FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC: 5.2.1.8] (inferred from 98% identity to amc:MADE_00743)

MetaCyc: 56% identical to peptidyl-prolyl cis-trans isomerase FklB (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FklB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>MIT1002_03490 FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase (Alteromonas macleodii MIT1002)
MTDTFNTVETQASYGIGFQMGQQLQSNPFDGLAIDAVVAGLKDAFAGQAPQVDNDTLRDA
FGEIHKRMQAAKEEASKAVIEEGTKYLEENAKRDEVTVTESGLQYEVIAEGDGETPVASS
TVRVHYHGTLINGTTFDSSYERGQPAEFPVGGVIKGWTEALQLMKVGAKYRLYVPHDLAY
GEQGAGAAIAPYSTLIFDVELLDVLG