Protein Info for MIT1002_03488 in Alteromonas macleodii MIT1002

Annotation: Na(+)-translocating NADH-quinone reductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF05896: NQRA_N" amino acids 15 to 107 (93 residues), 138.5 bits, see alignment E=1.4e-44 TIGR01936: NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit" amino acids 15 to 459 (445 residues), 616.4 bits, see alignment E=1.5e-189 PF24836: NQRA_2nd" amino acids 127 to 269 (143 residues), 191.3 bits, see alignment E=2e-60 PF11973: NQRA_SLBB" amino acids 274 to 322 (49 residues), 67.3 bits, see alignment 2.7e-22

Best Hits

Swiss-Prot: 65% identical to NQRA_SHEAM: Na(+)-translocating NADH-quinone reductase subunit A (nqrA) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00346, Na+-transporting NADH:ubiquinone oxidoreductase subunit A [EC: 1.6.5.-] (inferred from 98% identity to amc:MADE_00745)

MetaCyc: 65% identical to Na(+)-translocating NADH-quinone reductase subunit A (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit A (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>MIT1002_03488 Na(+)-translocating NADH-quinone reductase subunit A (Alteromonas macleodii MIT1002)
MQKGISIRVVRLHMIKIKKGLDLPIEGAPKQEIADASAATRVAILGEEYVGMRPTMHVQV
GDVVKKGQVLFEDKKNPGVKFTAPAAGEVVEVNRGAKRVLQSVVIKTNGSDAVTFDKIAA
DQIASATREQLQSILVESGMWTAFRTRPFSKSPKLDSVPSSIFVTAMDTNPLAADPAVII
AERQDDFVNGLKALTQLSGGKTYVCKAAGASVATGDAAVDVEEFGGPHPAGLPGTHIHFL
DSAGMNKTVWHINYQDVMAIGALLTSGELDNRRVISLAGPAATNPRLVRTVMGADLTELT
ASEQVDGEVRVISGSVLSGTTAMGVHGFLGRFHTQVSLLKEGREKKLFGWILPGSNQHSV
TRAYLGHLSGGKKFDMTTTTNGSERSMVPIGNYERVMPLDIIPTLLLRDLISGDTDGAQT
LGCLELDEEDLALCTYVCPGKYNYAPILRDCLTTIEKEG