Protein Info for MIT1002_03465 in Alteromonas macleodii MIT1002

Annotation: Putative aminoacrylate hydrolase RutD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR03611: pyrimidine utilization protein D" amino acids 24 to 278 (255 residues), 342 bits, see alignment E=1e-106 PF00561: Abhydrolase_1" amino acids 37 to 266 (230 residues), 81.4 bits, see alignment E=1.8e-26 PF12146: Hydrolase_4" amino acids 38 to 260 (223 residues), 56.9 bits, see alignment E=3.9e-19 PF12697: Abhydrolase_6" amino acids 39 to 261 (223 residues), 56.9 bits, see alignment E=9.6e-19 PF08386: Abhydrolase_4" amino acids 214 to 278 (65 residues), 22.8 bits, see alignment E=1.6e-08

Best Hits

Swiss-Prot: 59% identical to RUTD_PSEU5: Putative aminoacrylate hydrolase RutD (rutD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K09023, protein RutD (inferred from 78% identity to amc:MADE_00763)

Predicted SEED Role

"Possible hydrolase or acyltransferase RutD in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>MIT1002_03465 Putative aminoacrylate hydrolase RutD (Alteromonas macleodii MIT1002)
MHSEVQASYAHISGEMNGEMRNKLHYEIHGLTSPDAPTIVFSSGLGGAAKFWQPQLGDFA
QDYRVITYDHYGTNKSVGDLPANYSISHMADELAALLRKLEVQACHFVGHALGGLVGLEL
ALSKPKLLQSLVLVNAWSSPNPHTLRCFNIRKALLAAGRKDMYLQLQALLLFPPDWIAAN
AAHLAEEEAHLLNHFPNEENLLARIGALSTFNIDKSLHAITTPTLALANKDDTLVPWQRS
QMLAEAMPNAELSVMEYGGHASSITNTIAFNELLRSYLGQVA