Protein Info for MIT1002_03463 in Alteromonas macleodii MIT1002
Annotation: FMN reductase (NADH) RutF
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to RUTF_PSE14: FMN reductase (NADH) RutF (rutF) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 95% identity to amc:MADE_00765)MetaCyc: 50% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]
Predicted SEED Role
"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- dibenzothiophene desulfurization (1/5 steps found)
- bacterial bioluminescence (1/8 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Methane metabolism
- Tryptophan metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.5.1.-
Use Curated BLAST to search for 1.5.1.- or 1.5.1.42
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (176 amino acids)
>MIT1002_03463 FMN reductase (NADH) RutF (Alteromonas macleodii MIT1002) MTITAIKNAVTEVLPPVTPEAYREGMSSLAAAVNVVTTIGPEGRAGFTATAVCSVSDNPA TLLVCLNRGASVHQVFKNSTHLVINTLTSQHQLISNTFGGKAPMNERFEIGDWVESTTGC PRLADAAVSFDCIITDVKSVATHDVIFCQVVDIKQDPEADALLYYQRGYHSACKDA