Protein Info for MIT1002_03451 in Alteromonas macleodii MIT1002

Annotation: lactoylglutathione lyase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 TIGR03645: lactoylglutathione lyase family protein" amino acids 9 to 170 (162 residues), 344.1 bits, see alignment E=5.6e-108 PF00903: Glyoxalase" amino acids 13 to 156 (144 residues), 63.4 bits, see alignment E=4.1e-21 PF13669: Glyoxalase_4" amino acids 15 to 132 (118 residues), 31.1 bits, see alignment E=3.7e-11 PF18029: Glyoxalase_6" amino acids 16 to 153 (138 residues), 24.2 bits, see alignment E=6.5e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to amc:MADE_00775)

Predicted SEED Role

"Glyoxalase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>MIT1002_03451 lactoylglutathione lyase family protein (Alteromonas macleodii MIT1002)
MTEAVKTPYPRTFSHIGISVPDLEAAVKFYTEVLGWYLIMKPTEIVEDDSAIGEMCTDVF
GPGWGKFRIAHLSTGDRVGVEIFEFSNQENPENNFEYWKTGIFHFCVQDPDVEGLAEKIV
AAGGKKRMKAPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELHYASGAYE