Protein Info for MIT1002_03435 in Alteromonas macleodii MIT1002

Annotation: choice-of-anchor A domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 443 to 464 (22 residues), see Phobius details PF20597: pAdhesive_15" amino acids 29 to 120 (92 residues), 54.7 bits, see alignment E=7.5e-19 amino acids 132 to 415 (284 residues), 80.3 bits, see alignment E=1.1e-26 TIGR04215: choice-of-anchor A domain" amino acids 32 to 424 (393 residues), 108 bits, see alignment E=6.8e-35 TIGR02595: PEP-CTERM protein-sorting domain" amino acids 446 to 468 (23 residues), 16.9 bits, see alignment (E = 8.7e-07)

Best Hits

KEGG orthology group: None (inferred from 86% identity to amc:MADE_00791)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>MIT1002_03435 choice-of-anchor A domain protein (Alteromonas macleodii MIT1002)
MHKKILYTAVLAAVMSAPQVSAAKIELSEAFEYNAFIFDSFTGQSSDVEGRLAVGGEMNV
TDFNVGLLLSPDMSESALAVGGNLHFTRGDVHGGSTTVSGMVFGSELTFDKAVNAQQTVN
LINSTVKSGGISSKGDVKLGNSNVVSGDVHANTVKLGGPNSVYDSVSNPALYGSQVENGN
VFAESSVELDSSEVNGTVTLNDVNNYTAINGSTATSVEQGSVSKANVNNIDFNAIAAEVT
AQSQEFASMSVNGTTTLSCTDANDSDQAVACTDASKDVLNTITFSGSDDINIYNIDASWF
SAADKGIVYDFSTTSYNIINVYGESVELFNTGFFNTAFTQENEYFRENGQYRDNDNNVGQ
RHDGLYTNNILFNFVDADFLTLHSVGVKGSVLAPYAELSFYNGHVDGNVIANSLVTPLVQ
LINDDGETYNAPTGQVNNYQFGAINVSEPASIALLFGAGCFMLARRRKAN