Protein Info for MIT1002_03429 in Alteromonas macleodii MIT1002

Annotation: Peptide methionine sulfoxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 6 to 158 (153 residues), 208.8 bits, see alignment E=2.6e-66 PF01625: PMSR" amino acids 7 to 158 (152 residues), 225.9 bits, see alignment E=1.3e-71

Best Hits

Swiss-Prot: 56% identical to MSRA_NATPD: Peptide methionine sulfoxide reductase MsrA (msrA) from Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 95% identity to amc:MADE_03638)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>MIT1002_03429 Peptide methionine sulfoxide reductase MsrA (Alteromonas macleodii MIT1002)
MANLQVATLAGGCFWCIESAFNSVEGVEKAISGYAGGEKADPTYEEVCKGNTGHAEVVQV
TFDADSISYREILEIFFALHNPTQLNRQGNDVGTQYRSAVFYHDDTQKAEAEKIIAEITE
EEIWPDPVVTEIVAVNNYYDAEDYHQDYFKNNPQNQYCSMVVAPKLAKFKKTFASRLRSD
A