Protein Info for MIT1002_03426 in Alteromonas macleodii MIT1002

Annotation: Na+-dependent transporters of the SNF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 285 to 301 (17 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details amino acids 448 to 469 (22 residues), see Phobius details PF00209: SNF" amino acids 5 to 124 (120 residues), 86.4 bits, see alignment E=9.4e-29 amino acids 145 to 463 (319 residues), 86.6 bits, see alignment E=8.6e-29

Best Hits

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 97% identity to amc:MADE_03634)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>MIT1002_03426 Na+-dependent transporters of the SNF family protein (Alteromonas macleodii MIT1002)
MSGAREQFGSRIGFILAAAGSAVGIGNLVGFPVGAAKNGGGAFLLMYAIFVFAICLPVML
AEMSVGRHAKKDPLGAYSDISGNEKKWKVAGWLAIATPFMIAVFYMVITVWLFGYLFEAV
SGNLDKLANPETFGLFINSEAIFLYMAAVVGVVYLILQGGVKEGIEKAAKLLMPALFVML
IGLVIFVLTRENAMAGVEFYIVPEFSKITAEVVNGALSQAFFSLSLGMGILITYGSYIDK
RADVPSAAKLVALTDTAVAFTAGLMILPAIFSFNPDINPDDLSESSVGMIFTYLPSIFLA
LQDSIGYMGASIVASLFFLLVFFAAITSLVSIFEVPVAALMDEKGVSRKWALGSLGSIMI
LLAILSALSFGKVDMLTSFMHYAGADKSLFDVIYDVFYDTILPLNGLLICLFVIYRWKSA
NFNASLEEGSSGYKGSWFEKYVDISLKTFIPLILLVIFVNTVAVKYFGLSLFG