Protein Info for MIT1002_03387 in Alteromonas macleodii MIT1002

Annotation: putative tRNA-dihydrouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00742: tRNA dihydrouridine synthase A
  • amino acids 1 to 310 (310 residues), 449.9 bits, E=2.8e-139
• PF01207: Dus
  • amino acids 1 to 307 (307 residues), 286.7 bits, E=1e-89

Best Hits

Swiss-Prot: 63% identical to DUSA_VIBPA: tRNA-dihydrouridine(20/20a) synthase (dusA) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 94% identity to amc:MADE_03597)

Predicted SEED Role

"tRNA dihydrouridine synthase A"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (324 amino acids)

>MIT1002_03387 putative tRNA-dihydrouridine synthase (Alteromonas macleodii MIT1002)
MLDWTDRHCRYFLRLMSKHTLLYTEMVTTGAIIYGKGDYLGYNQEEHPVAVQLGGSDPSD
MAKCAELSQARGYDEVNINVGCPSDRVKNGSFGACLMAQPEVVASCVKAMQAAVDIPVTV
KCRIGIDDMDEDEDFARFIDTVADAGCDTFIVHARKAWLQGLSPKENREIPPLNYPRVHR
LKQARPELSISINGGVKTLEETQQQLELVDGVMVGREVYANPYIMATVDKEIFGDTEAQS
MSRREIVLKMQQYIERQDDPYFKPWHAARHILGLYQGQAGGRIWRRYLSQNGTGKNPDPN
LLLNALDAVESAQKEVAAFNSQKD