Protein Info for MIT1002_03355 in Alteromonas macleodii MIT1002

Annotation: CheY-P phosphatase CheC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 158 to 176 (19 residues), see Phobius details PF04509: CheC" amino acids 10 to 45 (36 residues), 31.6 bits, see alignment 1.2e-11 PF13690: CheX" amino acids 69 to 146 (78 residues), 28.1 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to amc:MADE_01456)

Predicted SEED Role

"Chemotaxis protein CheC -- inhibitor of MCP methylation" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>MIT1002_03355 CheY-P phosphatase CheC (Alteromonas macleodii MIT1002)
MSTVLSLDEEQRDALQELLNISMGQAANSLAQLIETKIGISIPKISAVTPTELYSLLFET
EDAFYTRQSFLGDVHGEVMSVLSQAGLNEVATLMDYDEPLSKEDIQEIILELCNILAGAC
LAGLSDQLELTTNLNMPTLFLPDKANFDELQWQHSLVMEVQFIIAISSFSMRVVFCLDDE
SLARMKDTLDELLA