Protein Info for MIT1002_03340 in Alteromonas macleodii MIT1002

Annotation: Oxygen sensor histidine kinase NreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 159 to 185 (27 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details PF05231: MASE1" amino acids 12 to 291 (280 residues), 49.2 bits, see alignment E=6.4e-17 PF07730: HisKA_3" amino acids 327 to 381 (55 residues), 32.2 bits, see alignment 2e-11 PF02518: HATPase_c" amino acids 426 to 519 (94 residues), 51.5 bits, see alignment E=1.9e-17

Best Hits

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>MIT1002_03340 Oxygen sensor histidine kinase NreB (Alteromonas macleodii MIT1002)
MNLTRYFNVTYLLMGLGYTALFHGVWLLSTQFEIISGTVSWYLPAGVRLAAFLLLPIYSW
PLLLIAEKLTHFILFHPGGILDNTAFLSGTIGWYLVHLVLSPAVICTCVYLFRRRFSAPY
IDNVSSTLATLAFGVLISVALGAVFLGRRAIELQTGIEVFLSILFDFSLGDFVGIVVLCP
FLFALYKRPSIPKSHLALYLTTIAWLVLLILSSYAYSQQINISYQVKYLAVFPALFLSYR
YAIVGSAFSCLLIGITAFVVASQSALPPIEHQFYILASCTSCLILGASINQSTLLNMKLA
KKNEALELSVQSAQALASQLVVVQEDERKRLSRDLHDDFGHRIVDLKLQLSLDSRESDND
MMLNKIDALYHAMKKSLGGLRPSGIDTLPIESVIQRSEIITTLKRANIDYSFNVSGTPVP
FDSDQKIHIYRIVQEAVTNSIKYANATSLSIDINYAQHSAVFTVTDDGGGIPEHIAQLAN
AEPTLGLLSMRERAKLINGEFDISQNKPSGTRVCLALPYRA