Protein Info for MIT1002_03333 in Alteromonas macleodii MIT1002

Annotation: curli production assembly/transport protein CsgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF03783: CsgG" amino acids 37 to 251 (215 residues), 225.6 bits, see alignment E=3e-71

Best Hits

Swiss-Prot: 45% identical to CSGG_ECOL6: Curli production assembly/transport component CsgG (csgG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06214, curli production assembly/transport component CsgG (inferred from 96% identity to amc:MADE_01506)

Predicted SEED Role

"Curli production assembly/transport component CsgG" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>MIT1002_03333 curli production assembly/transport protein CsgG (Alteromonas macleodii MIT1002)
MRSTVFLIVAMALAGCQSITNTLPPDTTAADVIKDSATLSEVKSLPAPMGQIPVSVYAFR
DQTGQYKPSTGASSFSTAVTQGATSILVQTLSETSWFLPVEREGLQNILTERKIIRADES
SGGDLPPLTTARIIIEGGIISYDTNIRTGGAGVEYFGIGASELFREDQISIYMRAVDVRT
GQVLVSVSTSKKVLSQEVRAGLFRYVSLKRLLEAETGYTTNEPMFECVKQSIEKAVTELV
LQGMEKGVWRAKA