Protein Info for MIT1002_03306 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details PF13347: MFS_2" amino acids 14 to 449 (436 residues), 200.7 bits, see alignment E=3.2e-63 PF07690: MFS_1" amino acids 26 to 388 (363 residues), 56.5 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: None (inferred from 48% identity to cro:ROD_19221)

Predicted SEED Role

"Rhamnogalacturonide transporter RhiT" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>MIT1002_03306 hypothetical protein (Alteromonas macleodii MIT1002)
MTRRELKPVNYIAYGLNDILGAGSMAVISGWILFFYTTFCGLSAVEAASIFAIARILDAV
ASPLIGHISDGLGNTRLGRRFGRRRVFLLFSIPLLPSFALMWVSGQHYLYYLVTYVFFEL
VYAAVIIPYETLAAEMTDDYKKKAKLAGARILTGQMSAILAGILPSWIVSSVGGKESAST
FLIMGVIFAALFMAVVFIVWLFTWEREQTGVSEDALAQERKGSVADTFKVLYTNLTSTLK
IRAFRLHLGMYLGGYISQDVFNAVFTYFVVFAIGGTVVVASEMMAVTYIAQLAAVAVAIP
LVMRFGPAPTYRVAISLYIVAIVALVAMYVMSGEFNLLWLAAGVIIAGLGRGALNYIPWN
TYNYMADVDQIVTAQRREGSFAGVMTFIRKATQALAVMSVGIILEMGGFISGADAQSDQA
VSTIVVMLAVGPIIVLLLGFYVSTFFKLSKETHEVLMGEIAHLKTGATAPTSEQNKRIVE
DLSGFKYDELWGRNNVGRFSPSFTKPGVRDALNEK