Protein Info for MIT1002_03304 in Alteromonas macleodii MIT1002

Annotation: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR01832: 2-deoxy-D-gluconate 3-dehydrogenase" amino acids 5 to 253 (249 residues), 351.2 bits, see alignment E=1.5e-109 PF00106: adh_short" amino acids 10 to 202 (193 residues), 195.6 bits, see alignment E=9.5e-62 PF08659: KR" amino acids 11 to 186 (176 residues), 51.8 bits, see alignment E=1.5e-17 PF13561: adh_short_C2" amino acids 16 to 250 (235 residues), 201.3 bits, see alignment E=2.7e-63

Best Hits

Swiss-Prot: 52% identical to KDUD_ECOLI: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Escherichia coli (strain K12)

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 61% identity to rmr:Rmar_2389)

MetaCyc: 54% identical to KduD (Dickeya dadantii 3937)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>MIT1002_03304 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (Alteromonas macleodii MIT1002)
MALNFELHGKTALVTGASRGIGQALAVGLAQSGATVICASSRKGGCDDTLAKIEELGLNA
YALSADLSDADATRALADEALTVTGSVDILVNNGGTIYRAPATEFPLEQWQKVMQVNIDS
AFILSQAIGKAMVKHGRGKIINIASMLSYSGGITVPAYTASKHAIAGLTKALANEWGQHN
IQVNAIAPGYIRTDNTQALQDDSERSNEILKRIPANRWGEAEDLQGAAVFLASDASAYVN
GHILAVDGGFLAR