Protein Info for MIT1002_03298 in Alteromonas macleodii MIT1002

Annotation: xylose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR02629: L-rhamnose catabolism isomerase" amino acids 10 to 420 (411 residues), 659.6 bits, see alignment E=9.3e-203 PF01261: AP_endonuc_2" amino acids 101 to 291 (191 residues), 40.1 bits, see alignment E=1.8e-14

Best Hits

Swiss-Prot: 63% identical to RHAL_RHIME: Probable sugar isomerase R00627 (R00627) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 64% identity to mpc:Mar181_0461)

Predicted SEED Role

"L-rhamnose isomerase (EC 5.3.1.14)" in subsystem L-rhamnose utilization (EC 5.3.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>MIT1002_03298 xylose isomerase (Alteromonas macleodii MIT1002)
MLKRIDQTLLEKENVTLKRDLEADYAALGEKLARSDVDIERLTCAAGEFQIAVPSWGTGT
GGTRFARFPGEGEPRNIWEKLEDCAVINELSGCTDSVSPHFPWDKVSDFSELKEKADEYG
IKWVSVNSNTFQDQVGQTASYKYGSLSNTQKASRELAIAHNLDCIEYGRKLGAKSLTVWV
GDGSNHPGQQHFQRAFERYLSSMEEIYKGLPDDWEIHIEHKMFEPAFYSTIIQDWGSNIL
AAMQLGPKCKSLVDLGHHAPNTNIEMIVSRLIQFKKLGGFHFNDSKYGDDDLDSGSLHPY
QQFLIFNELVDAEYRQQEEFGPAYMLDQSHNVTDPAESLINSAIEVQRSYVKALIVDREK
LYGYQDENDALMASLELKNAFNLDVSPILAMARLRKGAAIDPLAVYRKSNYRENMAKARP
RDPNATGSGIV