Protein Info for MIT1002_03291 in Alteromonas macleodii MIT1002

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 signal peptide" amino acids 21 to 21 (1 residues), see Phobius details transmembrane" amino acids 22 to 40 (19 residues), see Phobius details PF07715: Plug" amino acids 74 to 183 (110 residues), 44.2 bits, see alignment E=4.9e-15 PF00593: TonB_dep_Rec_b-barrel" amino acids 329 to 783 (455 residues), 116.7 bits, see alignment E=5.2e-37 PF14905: OMP_b-brl_3" amino acids 502 to 796 (295 residues), 34.3 bits, see alignment E=2.9e-12

Best Hits

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (830 amino acids)

>MIT1002_03291 TonB-dependent siderophore receptor (Alteromonas macleodii MIT1002)
MPTRISTKSSSQNVAQSPTHQLARSPFALAIIASAVTYAFSSAAEANDAMDHYEVIEVQG
ATPLSANSNNSAVFGNVQTLTQDDIEGSVNRSLPELLKTQLASVNLNDVQNNPFQPDLQY
RGFTASPLLGLPQGISVYLNGGRVNEAFGDTVHWDLMPLDAIDTVSLYSGSNPLFGQNTL
GGALALRTKTGFSFNANEIDLQAGQFGQKAASVESGGHNDHWAYYVNLNHYEEDGWRDYS
PSEVQQVFTSLAYKSDKMHLDMNLFMADNELLGNGASPIELLDIEGREAVYTHPDQTNNE
LTHVNITGDFVITDTLSLTANMFYRDTQTQSINGDDSDFGACQFADGRVTLCEFEDDDDD
DDAPLDSDDDGDDDDDDDLPVVGEGDDIEAVEFIGFDDDTALAEISDVDADELDGTYNTG
RTDAKATGLSFQLAKQYALSGFSSELIVGASYTKGDVNYAADTTFGILENESAQDSRTVL
PIDGLMAQEARVRLDVDTTAWSLFFMNSTQLSSAVSLNLGGRFNRDHIVMEDLIDDGEGS
LDGNHRFTQFNPAVGVDITIDEQSQLNLAISQSSRTPSPAELSCADEDDPCRLPNGFVAD
PPLDQVVTQTIEANYTTRIDNIDLMLNVFHSRSKGDIIFQQAGSVASRGYFINVDETQRQ
GVEFSVGSTWEKLTYRLNYNYLNATYESTFTSFSPFNPQGPDRLVTPGDKIPGQPEHLVK
LYADYALTDKARLGAEVISASSQYFRGDEANENEKIDGYVIANIYASYRFNDTFTASLRV
NNVFDKDYETFGTYGEADEVLEDIYPDVEGAEFVGPAQPRMVSVNLKARF