Protein Info for MIT1002_03286 in Alteromonas macleodii MIT1002

Annotation: Pyrroloquinoline quinone biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR02108: coenzyme PQQ biosynthesis protein B" amino acids 2 to 305 (304 residues), 396.4 bits, see alignment E=3.9e-123 PF12706: Lactamase_B_2" amino acids 50 to 273 (224 residues), 139 bits, see alignment E=8.1e-45

Best Hits

Swiss-Prot: 54% identical to PQQB_ACIAD: Coenzyme PQQ synthesis protein B (pqqB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K06136, pyrroloquinoline quinone biosynthesis protein B (inferred from 85% identity to alt:ambt_01165)

Predicted SEED Role

"Coenzyme PQQ synthesis protein B" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MIT1002_03286 Pyrroloquinoline quinone biosynthesis protein B (Alteromonas macleodii MIT1002)
MHVLILGAAAGGGFPQWNCHCPNCKGLREGKIKAKGRTQSSIAVSSDGKNWVLINASPDL
REQINSHPQLWPDAHVSRGTRISAIVLTDSQIDHTTGLLTLREGLPLPVYCTDVVAEDLT
TSFPLFTVLKHWHGGLQQHSINTDYHQRFVPKGAEGLTFQPVVLESNAPPYSTYRDNIVP
GNNIGLKITDDTTGNVLFYAPGCMQANDTVKQVMRESHCVLFDGTLWANEEMIDHGFSNK
LGTDMGHMPVNGKGGAIALLNEFNVERKVLIHINNTNRVLDEDSSAYHSLCEQGIELAYD
GMEIEV