Protein Info for MIT1002_03284 in Alteromonas macleodii MIT1002

Annotation: Daunorubicin/doxorubicin resistance ABC transporter permease protein DrrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 41 to 43 (3 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details TIGR03861: alcohol ABC transporter, permease protein" amino acids 3 to 253 (251 residues), 407.8 bits, see alignment E=9.9e-127 PF01061: ABC2_membrane" amino acids 9 to 223 (215 residues), 106.7 bits, see alignment E=1.2e-34 PF12698: ABC2_membrane_3" amino acids 54 to 246 (193 residues), 60.5 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 86% identity to alt:ambt_01175)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MIT1002_03284 Daunorubicin/doxorubicin resistance ABC transporter permease protein DrrB (Alteromonas macleodii MIT1002)
MYWRCFVGVLTREMLKFWQQRTRLLSALVRPLLWLFVFAAGFRSALGLSMTEPYESYILY
EEYIVPGLAAMIVLFNSMQSSLSMVYDREMGSMKVLLLSPVPRPFLLGSKLIANTLVSAI
QVYIFFAFALLLDVRLSALGYVYALPVIALLSLFLGSLGLLLANYIKQLENFAGVMNFVI
FPLFFLSSALYPLWKMREASEWLYQICAFNPFSSGVELLRFALYEKLEHNALAVVLCLTA
ITFILAVRSFRPKASKGRFS