Protein Info for MIT1002_03282 in Alteromonas macleodii MIT1002

Annotation: PQQ-dependent catabolism-associated beta-propeller protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 25 to 323 (299 residues), 477 bits, see alignment E=2.3e-147 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 27 to 61 (35 residues), 37.3 bits, see alignment 2.1e-13 amino acids 106 to 147 (42 residues), 36.9 bits, see alignment 2.7e-13 amino acids 286 to 322 (37 residues), 45.1 bits, see alignment 7.7e-16 PF21783: YNCE" amino acids 64 to 144 (81 residues), 28.9 bits, see alignment E=1.1e-10 PF10282: Lactonase" amino acids 183 to 320 (138 residues), 21.8 bits, see alignment E=1.5e-08

Best Hits

KEGG orthology group: None (inferred from 87% identity to alt:ambt_01185)

Predicted SEED Role

"FIG00443700: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MIT1002_03282 PQQ-dependent catabolism-associated beta-propeller protein (Alteromonas macleodii MIT1002)
MSYRFALLLGSLMASFALPQAFALPQAYVTNEKDNTLSVIDMTTFDVVETIEVGERPRGF
ILSADQSHAYICASDADRIQIMDLSTHSIVGDLPSGADPETIALHPNGTTIYTANEDDAL
LTVIDIPTAQVISQIDVGVEPEGLAVSHDGSMMVVTSETTNMVHWIDTNTHENIANSLVD
ARPRDAHFTRDDKYLWVSSEIGGTVSIFETATKQKVKTLSFAIKGVYRDKVQPVGIVLMK
DKPYAFVALGPANRIAVINTDTFEVEDYILVGRRVWQLAFNQDQSLLLTTNGVSGDVSVI
NTHTLNVEHTVKVGRYPWGVAVKWK