Protein Info for MIT1002_03271 in Alteromonas macleodii MIT1002

Annotation: Na/Pi-cotransporter II-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 50 to 76 (27 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 175 to 208 (34 residues), see Phobius details amino acids 210 to 239 (30 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 16 to 156 (141 residues), 135.7 bits, see alignment E=5.6e-44 amino acids 181 to 255 (75 residues), 34 bits, see alignment E=1.4e-12

Best Hits

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>MIT1002_03271 Na/Pi-cotransporter II-related protein (Alteromonas macleodii MIT1002)
MDSIVLLGNIIGGLGLFLLAIGMMTDGLKLAAGNALRTLLAKWSKTPFRGVLSGAAMTAL
VQSSSAVTVASLGFVNAGLLSMRHALGIVYGANIGTTMTGWLVALVGFKLNIQAVALPMI
GVGMILKLLKPNSRLASLGIAIAGFGLFFVGIDSLKTAFEGIVSTFDLSQFQASGIEGFL
MYLVIGFIMTVLTQSSSASIALTITAATSGMVGIYAAGAMVIGANIGTTSTALFASIGAT
SSAKRVATAQVIFNVTSAIVAALVLPLLFAFINWITAVADLEAAPGITLAIFHTLFNLLG
VALILPLNDWLTSFLERRFVSLEEKASKPKYLDKNIAQTPDLAVNALILELLSLSDRFLS
VYPKLLSQQSSEITVVENDLKSVEMLCQHISQFIVEVEREALSEQTTEALASLMRVEHYM
LSNAQKAEAISALSRRREVLAQPMLEGQFTNYLSVTNEFMKMVRWRQFDSSDALNVQFDL
LDKEHHTLKSALVLQATQGDISISQMTDATECMEFLLQIVHMWIKVFSRIQQVEDSITTA
NSTHGDTQQNVEGD