Protein Info for MIT1002_03268 in Alteromonas macleodii MIT1002

Annotation: putative manganese efflux pump MntP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details PF02659: Mntp" amino acids 31 to 180 (150 residues), 163.8 bits, see alignment E=1.3e-52

Best Hits

Swiss-Prot: 61% identical to MNTP_ALCBS: Putative manganese efflux pump MntP (mntP) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: None (inferred from 78% identity to alt:ambt_02885)

MetaCyc: 49% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>MIT1002_03268 putative manganese efflux pump MntP (Alteromonas macleodii MIT1002)
MSIFALILLAFAMSTDAFAAAIGKGVKINRPRLSFALKIGLLFGLIEATTPFIGWFIGRA
ASSYVEAWDHWIALIILSGLGIHMVLESLKPAEEESTSQKQSFILLCITALGTSIDAMAV
GASLALIEVNIAIAATLIGIATFSMVTIGIMLGSVMGTLIGKRAETFGGIVLVSVGTWIF
VSHTL