Protein Info for MIT1002_03265 in Alteromonas macleodii MIT1002

Annotation: carboxylate/amino acid/amine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details PF00892: EamA" amino acids 139 to 275 (137 residues), 30 bits, see alignment E=2.9e-11

Best Hits

Swiss-Prot: 50% identical to BIOP_ECOLI: Biotin transporter (bioP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to amc:MADE_01531)

MetaCyc: 50% identical to biotin transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-240

Predicted SEED Role

"Putative acetate efflux pump, MadN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>MIT1002_03265 carboxylate/amino acid/amine transporter (Alteromonas macleodii MIT1002)
MIYLIAVTVLWAFSFSLIGEFLAGSVDSYFAVLTRIVLATVVFLPFLKPALLSTKLKAIL
ASLGAVQLGLMYIFFYHAFLFLTVPEVLLFTIFTPLYVAILNDALFKRFTPFYLLCALIA
TAGAAIIRFNGVSENFWFGFAIVQGANLCFALGQVGYKKLTSTFETQMPYHNVFAWFYLG
ALAVALPAFSLFGNTSQLPQNPEQWGVLLWLGIVASGLGYYFWNQGALKVSGGTLAIMNN
ALIPAGLVVNLLLWQKDTDFSRLFLGGAIIALALWMSHQYSKKQERP