Protein Info for MIT1002_03257 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c biogenesis protein CcmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 73 to 89 (17 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details PF01790: LGT" amino acids 7 to 99 (93 residues), 44.3 bits, see alignment E=4.3e-15 PF00578: AhpC-TSA" amino acids 132 to 238 (107 residues), 46.1 bits, see alignment E=1.4e-15 PF08534: Redoxin" amino acids 136 to 246 (111 residues), 58.8 bits, see alignment E=1.7e-19 PF00085: Thioredoxin" amino acids 140 to 197 (58 residues), 36.1 bits, see alignment E=1.6e-12 PF13098: Thioredoxin_2" amino acids 148 to 255 (108 residues), 42.2 bits, see alignment E=2.7e-14 PF13905: Thioredoxin_8" amino acids 148 to 236 (89 residues), 30.9 bits, see alignment E=9e-11

Best Hits

KEGG orthology group: None (inferred from 52% identity to gag:Glaag_4469)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>MIT1002_03257 Cytochrome c biogenesis protein CcmG (Alteromonas macleodii MIT1002)
MMTSTALIIAGVIIFWSLVGYLARASKQKNEVTDTIFWSIAAGLVVARLIFVIDLWEIYQ
KDWLSVLNIRDGGFNSYSGWFAGLTVLLVRAKKHRQLMSFYLKSGAITAAALFPLVVIQT
LYNTSPSPLNINAQTSSGEYQSLELNIGKPVVINFWASWCPPCRREMPVLARAQQTQSDV
KFIFINQSEAPTKAERFLMSQGVDLENTYFDFAGNISKSFGAYGLPTTLFFNAKGELVDR
HMGELSEASLQHYLRPLLK