Protein Info for MIT1002_03252 in Alteromonas macleodii MIT1002

Annotation: Ferrichrome receptor FcuA precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07715: Plug" amino acids 68 to 165 (98 residues), 56.4 bits, see alignment E=3.9e-19 TIGR01783: TonB-dependent siderophore receptor" amino acids 74 to 722 (649 residues), 333.5 bits, see alignment E=1.6e-103 PF00593: TonB_dep_Rec_b-barrel" amino acids 245 to 688 (444 residues), 134 bits, see alignment E=1.4e-42

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 61% identity to rce:RC1_3892)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>MIT1002_03252 Ferrichrome receptor FcuA precursor (Alteromonas macleodii MIT1002)
MNLLKSALAVMIGLSSAGAPVYAQTEKNNNDDIEHITVDASQVELRDSFAGGQVSRGGRA
GILGNLDMMDSPFASTNFTADIIREQQARSIADVLQNDPVVRVAKGFGNFQELYVMRGFP
VYSDDMTYNGLYGVLPRQYVAAELSERVEVFRGASAFLNGAAPGGSGLGGSVNIVPKRAG
DDPLNRVTLGYESQGHWYGAADVSRRFGDDSQSTGVRANFVQRGGETSIDNQDRELSVAA
IGIDHDSDNFRLSLDLGYQDHQVDSPRPAVTPGSTIPEAPDSDTNFAQEWTYTNERQFFG
AVRGEYDFTDNITAWAAYGFRSGEEDNVFANPRQAEANGDFSAYRFDNVRNDEIRSGEVG
LNIEFKTASVGHTIITSASTFFLESENAYAFSDFSGFAGNIYNPVTATVPDADFFIGGDL
SNPLITEKTDLSSFALADMISFNDGKILLTLGGRVQNIETRTFDYNTGDELSGYDESQFT
PVVGIVYKSSEQVSYYANYIEGLLPGEVAPASSGGEPIENAGEAFDPYSAEQIEVGVKYD
AGQYGGSLSVFNTSKQSSIIKDNVFSTDGEQQNQGLELSVFGMPTSNLRVLGGFTWLDAE
MTKTQDGTLDGKTAIGVPDLQANINLEWDVDALPGLTVDARAAYTSKQYASADNSLEVDA
SNRFDLGVRYSFFAGMTDITLRARVDNVFDNNYWASVGGFPGSNYLVLSEPRTFRLSASF
NF