Protein Info for MIT1002_03251 in Alteromonas macleodii MIT1002

Annotation: Transport of quorum-sensing signal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 28 to 44 (17 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 268 to 296 (29 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 339 to 364 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 29 to 372 (344 residues), 150.7 bits, see alignment E=3.1e-48

Best Hits

KEGG orthology group: None (inferred from 49% identity to gag:Glaag_4229)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>MIT1002_03251 Transport of quorum-sensing signal protein (Alteromonas macleodii MIT1002)
MDNAGSNQDKGNAKYAGKFPKIAQQTRLLNILVIFAVIYTLYLAKSLLVPLFFSAFVALL
LSPLVAFARKLLIPRTLSAGALIALLVAPFTFLGIELAEPAERWMQSLPKIAAEISKEIE
EISSNIDAYATPPAEPVEKERSFFSWFGDDEKSPEISPPQDNTNSVTDKIKQSGIDIGLT
LFGNAPFLLAQVLACIVLIFFLLVFGPNLFNVFVRDFPIVTNKRRTLVLVDQIQRELSSY
IVTISIINSCLGLSTAGVFYYLGIDDALLWGALVALMNFVPYLGGVASCVVLLVVGLVQF
GLTNSAFLPAGLFLILNIIESQLITPAVLGRSMQLNPLIIIIWIAITGWLWGVVGVLLAV
PILMCFKIILENLGVFDHWIKLLESK