Protein Info for MIT1002_03237 in Alteromonas macleodii MIT1002

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details PF01545: Cation_efflux" amino acids 21 to 198 (178 residues), 75.1 bits, see alignment E=3.2e-25

Best Hits

KEGG orthology group: None (inferred from 80% identity to kdi:Krodi_1125)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>MIT1002_03237 cation diffusion facilitator family transporter (Alteromonas macleodii MIT1002)
MEPTRKSDLKKARTLQILNVIYDAIEVIVALIAGIIANSSALIGWALDSTIEVLSATTLG
WRLHGELKGIDKKQVNRRKKITLYVIAVSFTLVCIFISYDSVTKLLSQQTSSWSTMGLII
LVTSLLINPILIHFKRKYGRKLDSPALLADAKDTFICLYQTIVVLAGLLLVNWFGWWWAD
PVAALLIVPYAAKEGWEAYTKARDISIDEK