Protein Info for MIT1002_03207 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 201 to 224 (24 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details PF13795: HupE_UreJ_2" amino acids 187 to 383 (197 residues), 180.8 bits, see alignment E=1.1e-57

Best Hits

KEGG orthology group: None (inferred from 78% identity to amc:MADE_01566)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>MIT1002_03207 hypothetical protein (Alteromonas macleodii MIT1002)
MLMKYRPMLKVLPPFSKRVMIRFITLSIFAAFSVFTHSHELSNGYLTLKNDSNNTLSGEL
LLKPEDIGQAAGLDSNNDGNLTWGEVNRNHTMANDYIQNHLVIRDSETRCTVSIAPPSIR
DISAESLLVYPLSVNCVYVNEVSIQYTGIVSDFPTHKLLTTVTLNDHTRVYVLSDERSFI
TASATGNSWISQFGEMVYQGIWHIFIGLDHILFLVATLLTVNLYRENKSWVKEQSKRHII
KSTVILVSTFTLAHSITLTATALDFITLDSRIVELGIAISVAITALNNVYPIIMRLGFIT
FGFGLLHGMGFASVFGDLNAQSGSLVMNVFAFNIGVELGQLAIVTLLLPLLILLRNVRLY
SKAIMPIASSVIAVVAINWTLQRW