Protein Info for MIT1002_03199 in Alteromonas macleodii MIT1002

Annotation: Lipopolysaccharide export system permease protein LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 333 to 351 (19 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 4 to 353 (350 residues), 450.7 bits, see alignment E=1.3e-139 PF03739: LptF_LptG" amino acids 8 to 353 (346 residues), 276.6 bits, see alignment E=1.6e-86

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 93% identity to amc:MADE_01574)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>MIT1002_03199 Lipopolysaccharide export system permease protein LptG (Alteromonas macleodii MIT1002)
MFKILDLYIARTLLGTITVTLSVLIGLSALIKFIEQLRKIGEGDYDMLVAFIYVLLSLPR
DLEQFFPMATLLGGLIGMGVLASNSELVVMQAAGMSRWNIINSAMKSTLVMILLVMAVGE
WVTPYSETKAKQIRTEAISGGSLFSSDKLVWAKDGDRFVSIGQVLSQDSLKDVSIFSFNP
DLSLESITHAKNGAFDGDGWWLSDVEVTKFTETNVTVDENNRMRWNSTLTPDKLGIVAVK
PEALSITGLLDYVNYLENNDQDPSRYQLALWRKVFQPISVGVMLLMALSFIFGPLRSVTM
GARVIMGVLTGFGFFILNEVFGPVSLVYQLPPFLGALLPSLLFAAIAGVMLRR