Protein Info for MIT1002_03193 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF13416: SBP_bac_8" amino acids 65 to 336 (272 residues), 33.8 bits, see alignment E=3.3e-12 PF13343: SBP_bac_6" amino acids 165 to 364 (200 residues), 32.2 bits, see alignment E=8.2e-12

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 88% identity to amc:MADE_01580)

Predicted SEED Role

"Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein OppA (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) or Sex pheromones in Enterococcus faecalis and other Firmicutes (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>MIT1002_03193 hypothetical protein (Alteromonas macleodii MIT1002)
MPSNSDKNVASSFQRRTLLKGGLAFGLTAGITPFSIGKEKPTLRVLGTHVTLQEAIRQRA
MEDLGINIEFEPGGSAAVLQKASMNPTSFDLYEQWSNSINVLWRAHAIQPIEKKRLQYWE
EINDLSKTGKLTENARMGAGDAPHKIINIQDDGTLGANHTDTISFLPYVHNVDSFGYDTS
KLPKELQGQEESWGWLLDSRYSGKVGIVNDPTIGLFDLALAAQAKGFIQFQDIGAMTEYE
LDDLFSLLIELNQLNHFNGFWTSVPESIDFMKSGRVAIESMFSPAVSALNGQDIPVTFAA
PKEGYRGWHGVMCMSSATQGRIKDVAYEYMNWWLSGWPGAFIARQGYYISNPKRSAQYLS
DAEWNYWYKGQVASEPLKGPDGNISVKQGAQRTGGGYEERFSNVAVWNTIMPTYEYSLQK
WYEFITV