Protein Info for MIT1002_03183 in Alteromonas macleodii MIT1002

Annotation: Glutamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00653: glutamine synthetase, type I
  • amino acids 5 to 468 (464 residues), 694 bits, E=4.3e-213
• PF03951: Gln-synt_N
  • amino acids 15 to 95 (81 residues), 107.8 bits, E=1.8e-35
• PF00120: Gln-synt_C
  • amino acids 102 to 466 (365 residues), 471.4 bits, E=1.7e-145

Best Hits

Swiss-Prot: 78% identical to GLN1B_VIBAL: Glutamine synthetase (glnA) from Vibrio alginolyticus

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 98% identity to amc:MADE_01591)

MetaCyc: 74% identical to glutamine synthetase (Escherichia coli K-12 substr. MG1655)
Glutamate--ammonia ligase. [EC: 6.3.1.2]

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of ammonia assimilation (plants) (3/3 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• ammonia assimilation cycle II (2/2 steps found)
• L-glutamine biosynthesis I (1/1 steps found)
• L-aspartate degradation II (aerobic) (1/3 steps found)
• L-aspartate degradation III (anaerobic) (1/3 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.2

Protein Sequence (469 amino acids)

>MIT1002_03183 Glutamine synthetase (Alteromonas macleodii MIT1002)
MSVEKALELIKESEAKFVDLRFTDTKGKEQHVSIPASVVDEEFFEEGKMFDGSSIAGWKG
INESDMVLLPDATSCVVDPFAEETQVNIRCDIVEPSTMEGYERDPRSVARRAEEFLKSTG
IGDTCFFGPEPEFFLFDDVRFHTDMAGSFYKIDSSEAKWNSGEEFEGGNMAHRPGVKGGY
FPVPPVDSAHDIRAAMCLVMEEMGLVIEAHHHEVATAGQNEIACEFNTLVKKADEIQVYK
YVVHNVAHAYGQTATFMPKPLVGDNGSGMHCHQSISKDGVNIFAGDKYAGLSEEALYYIG
GIIKHARAINAFANASTNSYKRLVPGFEAPVMLAYSARNRSASIRIPHVTSDKARRIEVR
FPDPTANPYLAFTAMLMAGIDGIKNKIHPGDSMDKDLYDLPPEEAAEIPTVASSLEMALE
ALDNDRDFLKAGGVMTDDMIDAYIDLKSEEVTKLNMTTHPVEFDMYYSV