Protein Info for MIT1002_03176 in Alteromonas macleodii MIT1002

Annotation: Divalent metal cation transporter MntH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 272 to 301 (30 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details PF01566: Nramp" amino acids 20 to 371 (352 residues), 271.9 bits, see alignment E=4.2e-85

Best Hits

KEGG orthology group: None (inferred from 98% identity to amc:MADE_01595)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>MIT1002_03176 Divalent metal cation transporter MntH (Alteromonas macleodii MIT1002)
MAKDKSGYIIAAAFIGPGTVTTASLAGANFGFHLVWALLFSIFATIVLQDMAARLGVASG
QGLASAMKNMAYKPWLKNLFIVLIVSAIGIGNAAYESGNLTGAAIGLDAFISIGIGPWAS
ILGTIAIVLLWSGSYKWIETVLVYLVFIMAGVFLITLLVAKPDIAAMFSQLMSPRLDADA
ITTVLALIGTTIVPYNLFLHASLVAKSSKGQDKQEAVVACRNQSARAISMGGLITLIVMA
TAMMAFFNQAATMDASNMGEQLKPVLGDKAQWFFALGLFAAGLTSAITAPLAAAYAVTGA
LGLSDDMQSKSFKAVWFIIIVVGVSVAALGFKPLPAILFAQATNALLLPIIAIFLLVVMN
KSTALGELRNTWKSNLAGFLVVGTVIGLGLYKLIGVFS